Recombinant Human GEMIN7 Protein (1-131 aa), GST-tagged

Cat.No. : GEMIN7-1115H
Product Overview : Recombinant Human GEMIN7 Protein (1-131 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-131 aa
Description : The SMN complex plays a catalyst role in the assbly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assbly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assbly of core snRNPs and their transport to the nucleus.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 41.5 kDa
AA Sequence : MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name GEMIN7 gem (nuclear organelle) associated protein 7 [ Homo sapiens ]
Official Symbol GEMIN7
Synonyms GEMIN7; FLJ13956; gemin 7; gemin-7; SIP3;
Gene ID 79760
mRNA Refseq NM_001007269
Protein Refseq NP_001007270
MIM 607419
UniProt ID Q9H840

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GEMIN7 Products

Required fields are marked with *

My Review for All GEMIN7 Products

Required fields are marked with *

0
cart-icon
0
compare icon