Recombinant Human GEMIN7 Protein (1-131 aa), GST-tagged

• Cat.No.: GEMIN7-1115H
• Product Overview: Recombinant Human GEMIN7 Protein (1-131 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-131 aa
• Description: The SMN complex plays a catalyst role in the assbly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assbly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assbly of core snRNPs and their transport to the nucleus.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 41.5 kDa
• AA Sequence: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: GEMIN7 gem (nuclear organelle) associated protein 7 [ Homo sapiens ]
• Official Symbol: GEMIN7
• Synonyms: GEMIN7; FLJ13956; gemin 7; gemin-7; SIP3
• Gene ID: 79760
• mRNA Refseq: NM_001007269
• Protein Refseq: NP_001007270
• MIM: 607419
• UniProt ID: Q9H840