Recombinant Human GH1 Protein
Cat.No. : | GH1-111H |
Product Overview : | Recombinant Human GH1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Growth hormone (GH) is an important mitogenic growth factor that is synthesized, stored, and secreted by somatotropic cells of the anterior pituitary gland. GH stimulates growth, cell reproduction, and cell regeneration. In children, GH deficiencies can cause short stature, growth failure, and delayed sexual maturity. Adult GH deficiency presents with reduced lean body mass, increased adiposity, reduced muscle strength, and ultimately premature mortality. GH replacement therapy is used to treat many growth disorders, including Turner syndrome, chronic renal failure, and Prader–Willi syndrome. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 22.3 kDa (192 aa) |
AA Sequence : | MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium bicarbonate, pH 8.0 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | GH1 growth hormone 1 [ Homo sapiens (human) ] |
Official Symbol | GH1 |
Synonyms | GH1; growth hormone 1; somatotropin; GH; GH N; GHN; hGH N; pituitary growth hormone; GH-N; hGH-N; IGHD1B; |
Gene ID | 2688 |
mRNA Refseq | NM_000515 |
Protein Refseq | NP_000506 |
MIM | 139250 |
UniProt ID | P01241 |
◆ Recombinant Proteins | ||
GH1-30C | Recombinant Chicken Growth Hormone 1 | +Inquiry |
GH1-2776H | Recombinant Horse GH1 Protein, His-tagged | +Inquiry |
GH1-2010H | Recombinant Human GH1 Protein, His-tagged | +Inquiry |
GH1-002N | Recombinant Human Growth Hormone 1 (Active) , His-tagged | +Inquiry |
GH1-641H | Active Recombinant Human Growth Hormone 1 | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
0
Inquiry Basket