Recombinant Human GHRH Protein, GST-tagged

Cat.No. : GHRH-4888H
Product Overview : Human GHRH full-length ORF ( NP_066567.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. [provided by RefSeq
Molecular Mass : 38.8 kDa
AA Sequence : MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GHRH growth hormone releasing hormone [ Homo sapiens ]
Official Symbol GHRH
Synonyms GHRH; growth hormone releasing hormone; GHRF; somatoliberin; sermorelin; somatocrinin; somatorelin; growth hormone-releasing factor; growth hormone-releasing hormone; GRF; INN; MGC119781;
Gene ID 2691
mRNA Refseq NM_001184731
Protein Refseq NP_001171660
MIM 139190
UniProt ID P01286

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GHRH Products

Required fields are marked with *

My Review for All GHRH Products

Required fields are marked with *

0
cart-icon