Recombinant Human GLUL, His-tagged

Cat.No. : GLUL-27525TH
Product Overview : Recombinant full length Human Glutamine Synthetase with N-terminal His tag; 393 amino acids, MWt 44.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 373 amino acids
Description : The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling. This gene is expressed during early fetal stages, and plays an important role in controlling body pH by removing ammonia from circulation. Mutations in this gene are associated with congenital glutamine deficiency. Several alternatively spliced transcript variants have been found for this gene.
Conjugation : HIS
Molecular Weight : 44.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Sequence Similarities : Belongs to the glutamine synthetase family.
Gene Name GLUL glutamate-ammonia ligase [ Homo sapiens ]
Official Symbol GLUL
Synonyms GLUL; glutamate-ammonia ligase; GLNS, glutamate ammonia ligase (glutamine synthase); glutamine synthetase;
Gene ID 2752
mRNA Refseq NM_001033044
Protein Refseq NP_001028216
MIM 138290
Uniprot ID P15104
Chromosome Location 1q31
Pathway Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem;
Function ATP binding; glutamate decarboxylase activity; glutamate-ammonia ligase activity; identical protein binding; ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLUL Products

Required fields are marked with *

My Review for All GLUL Products

Required fields are marked with *

0
cart-icon