Recombinant Human GPR56 Protein, GST-tagged
Cat.No. : | GPR56-5254H |
Product Overview : | Human GPR56 full-length ORF ( AAH08770.1, 1 a.a. - 693 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the G protein-coupled receptor family. The protein contains 7 transmembrane domains and a mucin-like domain in the N-terminal region. The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space. Expression of this gene is downregulated in melanoma cell lines, and overexpression of this gene can suppress tumor growth and metastasis. Mutations in this gene result in bilateral frontoparietal polymicrogyria. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 104.1 kDa |
AA Sequence : | MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR56 G protein-coupled receptor 56 [ Homo sapiens ] |
Official Symbol | GPR56 |
Synonyms | GPR56; G protein-coupled receptor 56; G-protein coupled receptor 56; TM7LN4; TM7XN1; 7-transmembrane protein with no EGF-like N-terminal domains-1; BFPP; DKFZp781L1398; |
Gene ID | 9289 |
mRNA Refseq | NM_001145770 |
Protein Refseq | NP_001139242 |
MIM | 604110 |
UniProt ID | Q9Y653 |
◆ Recombinant Proteins | ||
GPR56-5253H | Recombinant Human GPR56 Protein | +Inquiry |
GPR56-2685Z | Recombinant Zebrafish GPR56 | +Inquiry |
GPR56-6944H | Recombinant Human GPR56 protein, His-tagged | +Inquiry |
GPR56-7194M | Recombinant Mouse GPR56 Protein | +Inquiry |
GPR56-1776R | Recombinant Rhesus Macaque GPR56 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR56-1821HCL | Recombinant Human GPR56 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR56 Products
Required fields are marked with *
My Review for All GPR56 Products
Required fields are marked with *