Recombinant Human GSTO1 Protein, GST-tagged
Cat.No. : | GSTO1-4424H |
Product Overview : | Human GSTO1 full-length ORF ( NP_004823.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq |
Molecular Mass : | 54 kDa |
AA Sequence : | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTO1 glutathione S-transferase omega 1 [ Homo sapiens ] |
Official Symbol | GSTO1 |
Synonyms | GSTO1; glutathione S-transferase omega 1; glutathione S-transferase omega-1; GSTTLp28; P28; GSTO-1; MMA(V) reductase; glutathione-S-transferase like; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; glutathione S-transferase omega 1-1; glutathione-dependent dehydroascorbate reductase; SPG-R; GSTO 1-1; DKFZp686H13163; |
Gene ID | 9446 |
mRNA Refseq | NM_001191002 |
Protein Refseq | NP_001177931 |
MIM | 605482 |
UniProt ID | P78417 |
◆ Recombinant Proteins | ||
Gsto1-1070M | Recombinant Mouse Gsto1 Protein, MYC/DDK-tagged | +Inquiry |
GSTO1-498H | Recombinant Human Glutathione S-transferase Omega 1 | +Inquiry |
Gsto1-619M | Recombinant Mouse Gsto1 protein, His & T7-tagged | +Inquiry |
GSTO1-28119TH | Recombinant Human GSTO1, His-tagged | +Inquiry |
GSTO1-2459H | Recombinant Human GSTO1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO1-761HCL | Recombinant Human GSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTO1 Products
Required fields are marked with *
My Review for All GSTO1 Products
Required fields are marked with *
0
Inquiry Basket