"GSTO1" Related Products

Expand
Expand
Expand

Recombinant Human GSTO1 Protein, GST-tagged

Cat.No. : GSTO1-4424H
Product Overview : Human GSTO1 full-length ORF ( NP_004823.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 54 kDa
AA Sequence : MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : GSTO1 glutathione S-transferase omega 1 [ Homo sapiens ]
Official Symbol : GSTO1
Synonyms : GSTO1; glutathione S-transferase omega 1; glutathione S-transferase omega-1; GSTTLp28; P28; GSTO-1; MMA(V) reductase; glutathione-S-transferase like; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; glutathione S-transferase omega 1-1; glutathione-dependent dehydroascorbate reductase; SPG-R; GSTO 1-1; DKFZp686H13163;
Gene ID : 9446
mRNA Refseq : NM_001191002
Protein Refseq : NP_001177931
MIM : 605482
UniProt ID : P78417

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.