Recombinant Human GSTP1 Protein, GST-tagged
Cat.No. : | GSTP1-4428H |
Product Overview : | Human GSTP1 full-length ORF ( AAH10915, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq |
Molecular Mass : | 48.84 kDa |
AA Sequence : | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ] |
Official Symbol | GSTP1 |
Synonyms | GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3; |
Gene ID | 2950 |
mRNA Refseq | NM_000852 |
Protein Refseq | NP_000843 |
MIM | 134660 |
UniProt ID | P09211 |
◆ Recombinant Proteins | ||
GSTP1-2999C | Recombinant Chinese hamster GSTP1 protein, His&Myc-tagged | +Inquiry |
GSTP1-9254Z | Recombinant Zebrafish GSTP1 | +Inquiry |
GSTP1-0313H | Recombinant Human GSTP1 Protein (M1-Q210), Tag Free | +Inquiry |
GSTP1-1086H | Active Recombinant Human GSTP1, His-tagged | +Inquiry |
GSTP1-580C | Recombinant Cynomolgus GSTP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *