Recombinant Human GUCA2A Protein, GST-tagged
Cat.No. : | GUCA2A-4487H |
Product Overview : | Human GUCA2A full-length ORF ( NP_291031.2, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GUCA2A (Guanylate Cyclase Activator 2A) is a Protein Coding gene. Diseases associated with GUCA2A include Cone-Rod Dystrophy and Cystic Fibrosis. Among its related pathways are Miscellaneous digestion events and Myometrial Relaxation and Contraction Pathways. GO annotations related to this gene include hormone activity and guanylate cyclase activator activity. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCA2A guanylate cyclase activator 2A (guanylin) [ Homo sapiens ] |
Official Symbol | GUCA2A |
Synonyms | GUCA2A; guanylate cyclase activator 2A (guanylin); GUCA2; guanylin; STARA; guanylate cyclase-activating protein 1; guanylate cyclase-activating protein I; guanylate cyclase activator 2A (guanylin 2, intestinal, heat-stable); GCAP-I; |
Gene ID | 2980 |
mRNA Refseq | NM_033553 |
Protein Refseq | NP_291031 |
MIM | 139392 |
UniProt ID | Q02747 |
◆ Recombinant Proteins | ||
GUCA2A-2406R | Recombinant Rat GUCA2A Protein, His (Fc)-Avi-tagged | +Inquiry |
GUCA2A-1518S | Recombinant SFTS virus GUCA2A protein, His-tagged | +Inquiry |
GUCA2A-28752TH | Recombinant Human GUCA2A | +Inquiry |
GUCA2A-86H | Recombinant Human Guanylate Cyclase Activator 2A | +Inquiry |
GUCA2A-975H | Recombinant Human GUCA2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2A Products
Required fields are marked with *
My Review for All GUCA2A Products
Required fields are marked with *
0
Inquiry Basket