Recombinant Human H2AFZ

Cat.No. : H2AFZ-29178TH
Product Overview : Recombinant full length protein of Human H2A.Z with proprietary tag; predicted MW 40.19 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.
Protein length : 128 amino acids
Molecular Weight : 40.190kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSR TTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK RITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV
Sequence Similarities : Belongs to the histone H2A family.
Gene Name : H2AFZ H2A histone family, member Z [ Homo sapiens ]
Official Symbol : H2AFZ
Synonyms : H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z;
Gene ID : 3015
mRNA Refseq : NM_002106
Protein Refseq : NP_002097
MIM : 142763
Uniprot ID : P0C0S5
Chromosome Location : 4q23
Pathway : Amyloids, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem;
Function : DNA binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All H2AFZ Products

Required fields are marked with *

My Review for All H2AFZ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends