Recombinant Human HOXB13 Protein, His-tagged

Cat.No. : HOXB13-41H
Product Overview : Recombinant Human HOXB13 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region.
Form : 50 mM Tris, 0.3 M NaCl, pH 8.0.
Molecular Mass : 33.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
Purity : >95%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.25 mg/mL
Gene Name HOXB13 homeobox B13 [ Homo sapiens (human) ]
Official Symbol HOXB13
Synonyms HPC9; PSGD
Gene ID 10481
mRNA Refseq NM_006361
Protein Refseq NP_006352
MIM 604607
UniProt ID Q92826

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB13 Products

Required fields are marked with *

My Review for All HOXB13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon