Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
166 |
Description : |
IFN-βs are proteins produced by many cell types including lymphocytes (NK cells, B-cells and T-cells), macrophages, fibroblasts, endothelial cells, osteoblasts and others. They have antiviral activity that it is mainly involved in innate immune response. The IFN-β family has 2 subtypes,which are IFN-β1 (IFNB1) and IFN-β3 (IFNB3) (a gene designated IFN-β2 is actually IL-6). IFN-β1 is used as a treatment for multiple sclerosis as it reduces the relapse rate. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, containing 2 % HSA and 3 % mannitol. |
Bio-activity : |
Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 3.0 × 10⁷ IU/mg. |
Molecular Mass : |
Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : |
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Endotoxin : |
Less than 1 EU/µg of rHuIFN-β1b as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |