Recombinant Human IFNB1 protein
Cat.No. : | IFNB1-08H |
Product Overview : | Recombinant Human IFNB1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 166 |
Description : | IFN-βs are proteins produced by many cell types including lymphocytes (NK cells, B-cells and T-cells), macrophages, fibroblasts, endothelial cells, osteoblasts and others. They have antiviral activity that it is mainly involved in innate immune response. The IFN-β family has 2 subtypes,which are IFN-β1 (IFNB1) and IFN-β3 (IFNB3) (a gene designated IFN-β2 is actually IL-6). IFN-β1 is used as a treatment for multiple sclerosis as it reduces the relapse rate. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, containing 2 % HSA and 3 % mannitol. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 3.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Endotoxin : | Less than 1 EU/µg of rHuIFN-β1b as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNB1 |
Official Symbol | IFNB1 |
Synonyms | IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956; |
Gene ID | 3456 |
mRNA Refseq | NM_002176 |
Protein Refseq | NP_002167 |
MIM | 147640 |
UniProt ID | P01574 |
◆ Recombinant Proteins | ||
Ifnb1-684M | Recombinant Mouse Interferon Beta 1, Fibroblast | +Inquiry |
Ifnb1-544M | Active Recombinant Mouse Ifnb1 | +Inquiry |
IFNB1-155H | Active Recombinant Human IFNB1 Protein (Met22-Asn187), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNB1-240C | Recombinant Cattle IFNB1 Protein, His-tagged | +Inquiry |
Ifnb1-7230M | Recombinant Mouse Ifnb1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *
0
Inquiry Basket