Recombinant Human IFNB1 protein

Cat.No. : IFNB1-08H
Product Overview : Recombinant Human IFNB1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 166
Description : IFN-βs are proteins produced by many cell types including lymphocytes (NK cells, B-cells and T-cells), macrophages, fibroblasts, endothelial cells, osteoblasts and others. They have antiviral activity that it is mainly involved in innate immune response. The IFN-β family has 2 subtypes,which are IFN-β1 (IFNB1) and IFN-β3 (IFNB3) (a gene designated IFN-β2 is actually IL-6). IFN-β1 is used as a treatment for multiple sclerosis as it reduces the relapse rate.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, containing 2 % HSA and 3 % mannitol.
Bio-activity : Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 3.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
AA Sequence : MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Endotoxin : Less than 1 EU/µg of rHuIFN-β1b as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IFNB1
Official Symbol IFNB1
Synonyms IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956;
Gene ID 3456
mRNA Refseq NM_002176
Protein Refseq NP_002167
MIM 147640
UniProt ID P01574

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNB1 Products

Required fields are marked with *

My Review for All IFNB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon