Active Recombinant Human IL15 Protein, His-tagged
Cat.No. : | IL15-004H |
Product Overview : | Recombinant human IL-15 protein (49-162 aa), fused to His-tag was expressed in E.coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 49-162 a.a. |
Description : | Interleukin (IL)-15 is a pleiotropic cytokine that plays a pivotal role in both innate and adaptive immunity. IL-15 is unique among cytokines due to its participation in a trans signaling mechanism in which IL-15 receptor alpha (IL-15R alpha) from one subset of cells presents IL-15 to neighboring IL-2R beta/gamma(c)-expressing cells. This newly discovered cytokine is produced by a wide variety of cells and tissues and like IL-2, stimulates the proliferation of T-lymphocytes and induces the generation of cytotoxic T-lymphocytes (CTLs) and lymphokine-activated killer (LAK) cells. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 1 ng/mL. |
Molecular Mass : | 13.9 kDa (123aa) confirmed by MALDI-TOF |
AA Sequence : | MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH |
Endotoxin : | < 1.0 EU per 1μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterin. |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | In Phosphate Buffer Saline(pH7.4) containing 10% glycerol. |
Gene Name | IL15 interleukin 15 [ Homo sapiens (human) ] |
Official Symbol | IL15 |
Synonyms | Interleukin-15; IL-15; interleukin-15 |
Gene ID | 3600 |
mRNA Refseq | NM_172175 |
Protein Refseq | NP_751914 |
MIM | 600554 |
UniProt ID | P40933 |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
0
Inquiry Basket