Recombinant Human IL20RB Protein, Fc-tagged

Cat.No. : IL20RB-324H
Product Overview : Recombinant human IL20RB protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 311
Description : IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).
Form : Lyophilized
Molecular Mass : 49.1 kDa
AA Sequence : MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name IL20RB interleukin 20 receptor beta [ Homo sapiens (human) ]
Official Symbol IL20RB
Synonyms IL20RB; interleukin 20 receptor beta; fibronectin type III domain containing 6 , FNDC6; interleukin-20 receptor subunit beta; DIRS1; IL 20R2; MGC34923; IL-20RB; IL-20R-beta; interleukin-20 receptor II; IL-20 receptor subunit beta; fibronectin type III domain containing 6; FNDC6; IL-20R2;
Gene ID 53833
mRNA Refseq NM_144717
Protein Refseq NP_653318
MIM 605621
UniProt ID Q6UXL0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL20RB Products

Required fields are marked with *

My Review for All IL20RB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon