Recombinant Human INHA, GST-tagged

Cat.No. : INHA-512H
Product Overview : Recombinant Human INHA(1 a.a. - 366 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-366 a.a.
Description : This gene encodes the alpha subunit of inhibins A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa): 66
AA Sequence : MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPE EEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP LLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPS GGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name INHA inhibin, alpha [ Homo sapiens ]
Official Symbol INHA
Synonyms inhibin alpha chain; A-inhibin subunit
Gene ID 3623
mRNA Refseq NM_002191
Protein Refseq NP_002182
MIM 147380
UniProt ID P05111
Chromosome Location 2q35
Pathway Glycoprotein hormones, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Ovarian Infertility Genes, organism-specific biosystem
Function cytokine activity; growth factor activity; hormone activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHA Products

Required fields are marked with *

My Review for All INHA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon