Recombinant Human INHBC, His-tagged
Cat.No. : | INHBC-116H |
Product Overview : | Recombinant Human Inhibin β C Chain/INHBC is produced by our E.coli expression system. The target protein is expressed with sequence (Gly237-Ser352) of Human INHBC fused with a 6His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237-352 a.a. |
Description : | Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins,Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. |
Form : | Lyophilized from a 0.2 μM filtered solution of 4mM HCl, 1mM DTT |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC PLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMV VEACGCS |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | INHBC inhibin, beta C [ Homo sapiens ] |
Official Symbol | INHBC |
Synonyms | INHBC; inhibin, beta C; inhibin beta C chain; activin beta-C chain; IHBC; |
Gene ID | 3626 |
mRNA Refseq | NM_005538 |
Protein Refseq | NP_005529 |
MIM | 601233 |
UniProt ID | P55103 |
Chromosome Location | 12q13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; |
Function | growth factor activity; hormone activity; transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
Inhbc-3539M | Recombinant Mouse Inhbc Protein, Myc/DDK-tagged | +Inquiry |
INHBC-5116H | Recombinant Human INHBC Protein, GST-tagged | +Inquiry |
Inhbc-01M | Active Recombinant Mouse Inhbc Protein | +Inquiry |
INHBC-01H | Active Recombinant Human INHBC Protein | +Inquiry |
INHBC-15867H | Recombinant Human INHBC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBC-346HCL | Recombinant Human INHBC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INHBC Products
Required fields are marked with *
My Review for All INHBC Products
Required fields are marked with *
0
Inquiry Basket