Recombinant Human INHBC, His-tagged

Cat.No. : INHBC-116H
Product Overview : Recombinant Human Inhibin β C Chain/INHBC is produced by our E.coli expression system. The target protein is expressed with sequence (Gly237-Ser352) of Human INHBC fused with a 6His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 237-352 a.a.
Description : Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins,Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland.
Form : Lyophilized from a 0.2 μM filtered solution of 4mM HCl, 1mM DTT
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC PLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMV VEACGCS
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name INHBC inhibin, beta C [ Homo sapiens ]
Official Symbol INHBC
Synonyms INHBC; inhibin, beta C; inhibin beta C chain; activin beta-C chain; IHBC;
Gene ID 3626
mRNA Refseq NM_005538
Protein Refseq NP_005529
MIM 601233
UniProt ID P55103
Chromosome Location 12q13
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem;
Function growth factor activity; hormone activity; transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBC Products

Required fields are marked with *

My Review for All INHBC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon