Recombinant Human KLK3 Protein, GST-tagged

Cat.No. : KLK3-4937H
Product Overview : Human KLK3 full-length ORF ( AAH05307, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 54.45 kDa
AA Sequence : MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLK3 kallikrein-related peptidase 3 [ Homo sapiens ]
Official Symbol KLK3
Synonyms KLK3; kallikrein-related peptidase 3; APS, kallikrein 3, (prostate specific antigen); prostate-specific antigen; PSA; seminin; P-30 antigen; kallikrein-3; semenogelase; gamma-seminoprotein; prostate specific antigen; APS; hK3; KLK2A1;
Gene ID 354
mRNA Refseq NM_001030047
Protein Refseq NP_001025218
MIM 176820
UniProt ID P07288

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK3 Products

Required fields are marked with *

My Review for All KLK3 Products

Required fields are marked with *

0
cart-icon