Recombinant Human KRT80 protein, His-tagged
Cat.No. : | KRT80-471H |
Product Overview : | Recombinant Human KRT80 protein(1-422 aa), fused with His tag, was expressed in E.coli. |
Availability | May 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-422 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KRT80 keratin 80 [ Homo sapiens ] |
Official Symbol | KRT80 |
Synonyms | KRT80; keratin 80; keratin, type II cytoskeletal 80; KB20; K80; CK-80; keratin-80; keratin b20; cytokeratin-80; type II keratin; type-II keratin Kb20; |
Gene ID | 144501 |
mRNA Refseq | NM_001081492 |
Protein Refseq | NP_001074961 |
MIM | 611161 |
UniProt ID | Q6KB66 |
◆ Recombinant Proteins | ||
KRT80-3333R | Recombinant Rat KRT80 Protein | +Inquiry |
KRT80-471H | Recombinant Human KRT80 protein, His-tagged | +Inquiry |
KRT80-8856M | Recombinant Mouse KRT80 Protein | +Inquiry |
KRT80-4942M | Recombinant Mouse KRT80 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT80-2989R | Recombinant Rat KRT80 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT80 Products
Required fields are marked with *
My Review for All KRT80 Products
Required fields are marked with *
0
Inquiry Basket