Recombinant Human LAG3 Protein, Fc-tagged
Cat.No. : | LAG3-677H |
Product Overview : | Recombinant human LAG3 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 525 |
Description : | Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. |
Form : | Lyophilized |
Molecular Mass : | 72.3 kDa |
AA Sequence : | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LAG3 lymphocyte-activation gene 3 [ Homo sapiens (human) ] |
Official Symbol | LAG3 |
Synonyms | LAG3; lymphocyte-activation gene 3; lymphocyte activation gene 3 protein; CD223; |
Gene ID | 3902 |
mRNA Refseq | NM_002286 |
Protein Refseq | NP_002277 |
MIM | 153337 |
UniProt ID | P18627 |
◆ Recombinant Proteins | ||
LAG3-467HB | Recombinant Human LAG3 protein, Biotinylated | +Inquiry |
Lag3-39RAF488 | Recombinant Rat Lag3 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
LAG3-467H | Recombinant Human LAG3 protein(Met1-Arg440) | +Inquiry |
LAG3-385H | Active Recombinant Human LAG3 Protein, MIgG2a Fc & Avi-tagged, Biotinylated | +Inquiry |
LAG3-387M | Active Recombinant Marmoset LAG3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
0
Inquiry Basket