Recombinant Human LILRB4 protein, GST-tagged
Cat.No. : | LILRB4-146H |
Product Overview : | Recombinant Human LILRB4(1 a.a. - 448 a.a.) fused with GST tag at the N-terminus was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-448 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 75.02 kDa |
AA Sequence : | MIPTFTALLCLGLSLGPRTDMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWDRQNPL EPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPM DTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPR PSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASP PSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYARLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Gene Name | LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 [ Homo sapiens ] |
Official Symbol | LILRB4 |
Synonyms | HM18; ILT3; LIR5; CD85K; LIR-5; LILRB5 |
Gene ID | 11006 |
mRNA Refseq | NM_006847.3 |
Protein Refseq | NP_006838.3 |
MIM | 604821 |
UniProt ID | Q8NHJ6 |
Chromosome Location | 19q13.4 |
Pathway | Adaptive Immune System, organism-specific biosystem;Immune System, organism-specific biosystem;Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;Osteoclast differentiation, organism-specific biosystem;Osteoclast differentiation, conserved biosystem; |
Function | antigen binding;protein binding;receptor activity; |
◆ Recombinant Proteins | ||
LILRB4-13H | Recombinant Human LILRB4 Protein, HIgG1 Fc-tagged | +Inquiry |
LILRB4-1583H | Recombinant Human LILRB4 protein, His-Avi-tagged | +Inquiry |
LILRB4-0339M | Recombinant Mouse LILRB4 protein, Fc-tagged | +Inquiry |
LILRB4-0338H | Active Recombinant Human LILRB4 protein, His-tagged, FITC-Labeled | +Inquiry |
LILRB4-316M | Recombinant Mouse LILRB4 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB4-380HCL | Recombinant Human LILRB4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB4 Products
Required fields are marked with *
My Review for All LILRB4 Products
Required fields are marked with *