Recombinant Human MIA Protein, GST-tagged
Cat.No. : | MIA-5314H |
Product Overview : | Human MIA full-length ORF ( AAH05910, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MIA (Melanoma Inhibitory Activity) is a Protein Coding gene. Diseases associated with MIA include Melanoma and Skin Melanoma. Among its related pathways are Neural Crest Differentiation. GO annotations related to this gene include growth factor activity. An important paralog of this gene is MIA-RAB4B. |
Molecular Mass : | 40.15 kDa |
AA Sequence : | MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIA melanoma inhibitory activity [ Homo sapiens ] |
Official Symbol | MIA |
Synonyms | MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP; |
Gene ID | 8190 |
mRNA Refseq | NM_001202553 |
Protein Refseq | NP_001189482 |
MIM | 601340 |
UniProt ID | Q16674 |
◆ Recombinant Proteins | ||
MIA-5314H | Recombinant Human MIA Protein, GST-tagged | +Inquiry |
MIA-2589R | Recombinant Rhesus Macaque MIA Protein, His (Fc)-Avi-tagged | +Inquiry |
MIA-2440H | Recombinant Human MIA Protein, His-tagged | +Inquiry |
MIA-6549HF | Recombinant Full Length Human MIA Protein, GST-tagged | +Inquiry |
MIA-400H | Recombinant Human melanoma inhibitory activity, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIA-4325HCL | Recombinant Human MIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIA Products
Required fields are marked with *
My Review for All MIA Products
Required fields are marked with *
0
Inquiry Basket