Recombinant Human MIF, His-tagged N-Terminus

• Cat.No.: MIF-24H
• Product Overview: Recombinant human macrophage migration inhibitory factor (glycosylation-inhibiting factor), fused to His-tag at N-terminus, was cloned into anE. coliexpression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor is a single, non-glycosylated, polypeptide chain containing amino acids from 1-114 and having a molecular mass of 16.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-114 a.a.
• Description: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
• Physical Appearance: 1mg/ml solution containing PBS pH-7.4.
• Amino Acid Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Storage: Liquid MIF although stable 14℃ for 1 week, should be stored desiccated below -18℃. Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
• Synonyms: MIF; macrophage migration inhibitory factor; GIF; GLIF; MMIF; phenylpyruvate tautomerase; glycosylation-inhibiting factor; EC 5.3.2.1; Glycosylation-inhibiting factor; Phenylpyruvate tautomerase
• Gene ID: 4282
• mRNA Refseq: NM_002415
• Protein Refseq: NP_002406
• MIM: 153620
• UniProt ID: P14174
• Chromosome Location: 22q11.23
• Pathway: Phenylalanine metabolism; Tyrosine metabolism
• Function: cytokine activity; dopachrome isomerase activity; isomerase activity; phenylpyruvate tautomerase activity;protein binding

Citation

Exonuclease resistant 18S and 25S ribosomal RNA components in yeast are possibly newly transcribed by RNA polymerase II

Journal: BMC Molecular and Cell Biology    PubMed ID: 32738873    Data: 2020/8/1

Authors: Jacob Fleischmann, Miguel A. Rocha, Mary Grace D. Pilapil

Article Snippet:Two micrograms of total RNA from C. albicans were incubated with 1 μg of recombinant human eIF4E protein fused to His-tag at N-terminus (Creative BioMart) in binding buffer (25 mM Tris, pH 8.0, 150 mM NaCl, 1 mM DTT, 5 mM imidazole) and incubated at 4 °C overnight.. HisPur? Ni-NTA magnetic beads (ThermoFisher Scientific) were added to the RNA-eIF4E mixture and placed on ice for 10 min. A magnetic stand was used to collect the beads after three washes with binding buffer.HisPur? Ni-NTA magnetic beads (ThermoFisher Scientific) were added to the RNA-eIF4E mixture and placed on ice for 10 min. A magnetic stand was used to collect the beads after three washes with binding buffer.

RNA Polymerase II is involved in 18S and 25S ribosomal RNA transcription, in Candida albicans

Journal: bioRxiv    Data: 2019/1/16

Authors: Fleischmann Jacob, Rocha Miguel A., Hauser Peter V

Article Snippet:PrePrint: One μg of total RNA from C. albicans was incubated with 2 μg of recombinant human EIF4E protein fused to His-tag at N-terminus (Creative BioMart) in binding buffer (25mM Tris, pH 8.0, 150mM NaCl, 1mM DTT, 5mM imidazole) and incubated at 4°C overnight.. HisPur? Ni-NTA magnetic beads (ThermoFisher Scientific) were added to the RNA-EIF4E mixture and placed on ice for 10 minutes.HisPur? Ni-NTA magnetic beads (ThermoFisher Scientific) were added to the RNA-EIF4E mixture and placed on ice for 10 minutes.