Recombinant Human NCAM1

Cat.No. : NCAM1-30370TH
Product Overview : Recombinant fragment corresponding to amino acids 611-710 of Human NCAM with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Sequence Similarities : Contains 2 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name NCAM1 neural cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol NCAM1
Synonyms NCAM1; neural cell adhesion molecule 1; CD56; NCAM;
Gene ID 4684
mRNA Refseq NM_000615
Protein Refseq NP_000606
MIM 116930
Uniprot ID P13591
Chromosome Location 11q23-q24
Pathway Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Developmental Biology, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAM1 Products

Required fields are marked with *

My Review for All NCAM1 Products

Required fields are marked with *

0
cart-icon