Recombinant Human NCR2 Protein, C-His-tagged
Cat.No. : | NCR2-188H |
Product Overview : | Recombinant Human NCR2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Natural killer (NK) cells direct cytotoxicity against tumor or virally infected cells. NK cell-mediated cytotoxicity is stimulated by several activating receptors associated with the signaling adapter DNAX activation 12/killer cellactivating receptor-associated protein (DAP12). NKp44 is a natural cytotoxicity receptor that is expressed on IL-2-activated human NK cells and may contribute to the increased efficiency of NK cells to mediate tumor cell lysis. NKp44 is composed of one Ig-like extracellular domain, a transmembrane segment and a cytoplasmic domain. Prolactin upregulates and cortisol downregulates the surface expression of NKp44 at the transcriptional level. A cellular ligand for NKp44 (NKp44L) is expressed during HIV-1 infection and is correlated with the progression of CD4+ T cell depletion and an increase of viral load. This implicates NKp44 as a therapeutic agent that may aid in the progress towards a vaccine for HIV-1 infection. |
Molecular Mass : | ~19 kDa |
AA Sequence : | QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIA |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | NCR2 natural cytotoxicity triggering receptor 2 [ Homo sapiens (human) ] |
Official Symbol | NCR2 |
Synonyms | NCR2; natural cytotoxicity triggering receptor 2; LY95, lymphocyte antigen 95 (activating NK receptor; NK p44); CD336; NK p44; NK cell-activating receptor; NK cell activating receptor (NKp44); natural killer cell p44-related protein; lymphocyte antigen 95 (activating NK-receptor; NK-p44); lymphocyte antigen 95 homolog (activating NK-receptor; LY95; NKP44; NK-p44; dJ149M18.1; |
Gene ID | 9436 |
mRNA Refseq | NM_001199509 |
Protein Refseq | NP_001186438 |
MIM | 604531 |
UniProt ID | O95944 |
◆ Recombinant Proteins | ||
NCR2-151H | Recombinant Human NCR2 Protein, His-tagged | +Inquiry |
NCR2-1758R | Recombinant Rhesus Monkey NCR2 Protein | +Inquiry |
NCR2-1760R | Recombinant Rhesus Monkey NCR2 Protein, hIgG4-tagged | +Inquiry |
NCR2-0579H | Recombinant Human NCR2 protein, lFc-tagged | +Inquiry |
NCR2-236H | Recombinant Human NCR2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCR2-2109HCL | Recombinant Human NCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCR2 Products
Required fields are marked with *
My Review for All NCR2 Products
Required fields are marked with *
0
Inquiry Basket