Recombinant Human NCR2 Protein, C-His-tagged

• Cat.No.: NCR2-188H
• Product Overview: Recombinant Human NCR2 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Natural killer (NK) cells direct cytotoxicity against tumor or virally infected cells. NK cell-mediated cytotoxicity is stimulated by several activating receptors associated with the signaling adapter DNAX activation 12/killer cellactivating receptor-associated protein (DAP12). NKp44 is a natural cytotoxicity receptor that is expressed on IL-2-activated human NK cells and may contribute to the increased efficiency of NK cells to mediate tumor cell lysis. NKp44 is composed of one Ig-like extracellular domain, a transmembrane segment and a cytoplasmic domain. Prolactin upregulates and cortisol downregulates the surface expression of NKp44 at the transcriptional level. A cellular ligand for NKp44 (NKp44L) is expressed during HIV-1 infection and is correlated with the progression of CD4+ T cell depletion and an increase of viral load. This implicates NKp44 as a therapeutic agent that may aid in the progress towards a vaccine for HIV-1 infection.
• Molecular Mass: ~19 kDa
• AA Sequence: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIA
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: NCR2 natural cytotoxicity triggering receptor 2 [ Homo sapiens (human) ]
• Official Symbol: NCR2
• Synonyms: NCR2; natural cytotoxicity triggering receptor 2; LY95, lymphocyte antigen 95 (activating NK receptor; NK p44); CD336; NK p44; NK cell-activating receptor; NK cell activating receptor (NKp44); natural killer cell p44-related protein; lymphocyte antigen 95 (activating NK-receptor; NK-p44); lymphocyte antigen 95 homolog (activating NK-receptor; LY95; NKP44; NK-p44; dJ149M18.1
• Gene ID: 9436
• mRNA Refseq: NM_001199509
• Protein Refseq: NP_001186438
• MIM: 604531
• UniProt ID: O95944