Recombinant Human NCR2 Protein, C-His-tagged
| Cat.No. : | NCR2-188H |
| Product Overview : | Recombinant Human NCR2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Natural killer (NK) cells direct cytotoxicity against tumor or virally infected cells. NK cell-mediated cytotoxicity is stimulated by several activating receptors associated with the signaling adapter DNAX activation 12/killer cellactivating receptor-associated protein (DAP12). NKp44 is a natural cytotoxicity receptor that is expressed on IL-2-activated human NK cells and may contribute to the increased efficiency of NK cells to mediate tumor cell lysis. NKp44 is composed of one Ig-like extracellular domain, a transmembrane segment and a cytoplasmic domain. Prolactin upregulates and cortisol downregulates the surface expression of NKp44 at the transcriptional level. A cellular ligand for NKp44 (NKp44L) is expressed during HIV-1 infection and is correlated with the progression of CD4+ T cell depletion and an increase of viral load. This implicates NKp44 as a therapeutic agent that may aid in the progress towards a vaccine for HIV-1 infection. |
| Molecular Mass : | ~19 kDa |
| AA Sequence : | QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIA |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | NCR2 natural cytotoxicity triggering receptor 2 [ Homo sapiens (human) ] |
| Official Symbol | NCR2 |
| Synonyms | NCR2; natural cytotoxicity triggering receptor 2; LY95, lymphocyte antigen 95 (activating NK receptor; NK p44); CD336; NK p44; NK cell-activating receptor; NK cell activating receptor (NKp44); natural killer cell p44-related protein; lymphocyte antigen 95 (activating NK-receptor; NK-p44); lymphocyte antigen 95 homolog (activating NK-receptor; LY95; NKP44; NK-p44; dJ149M18.1; |
| Gene ID | 9436 |
| mRNA Refseq | NM_001199509 |
| Protein Refseq | NP_001186438 |
| MIM | 604531 |
| UniProt ID | O95944 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR2 Products
Required fields are marked with *
My Review for All NCR2 Products
Required fields are marked with *
