Recombinant Human NME2 Protein, GST-tagged
Cat.No. : | NME2-5926H |
Product Overview : | Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by NME1) and B (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq |
Molecular Mass : | 42.46 kDa |
AA Sequence : | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ] |
Official Symbol | NME2 |
Synonyms | NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212; |
Gene ID | 4831 |
mRNA Refseq | NM_001018137 |
Protein Refseq | NP_001018147 |
MIM | 156491 |
UniProt ID | P22392 |
◆ Recombinant Proteins | ||
NME2-3055R | Recombinant Rhesus monkey NME2 Protein, His-tagged | +Inquiry |
NME2-6604C | Recombinant Chicken NME2 | +Inquiry |
NME2-4004R | Recombinant Rat NME2 Protein | +Inquiry |
NME2-3279H | Recombinant Human NME2 protein, His&Myc-tagged | +Inquiry |
NME2-1311H | Recombinant Human NME2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME2-3791HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
NME2-3790HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME2 Products
Required fields are marked with *
My Review for All NME2 Products
Required fields are marked with *
0
Inquiry Basket