Recombinant Human NNMT Protein, GST-tagged NNMT-5956H

Cat.No.:	NNMT-5956H
Product Overview:	Human NNMT full-length ORF ( AAH00234, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	54.78 kDa
AA Sequence:	MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Download Datasheet

Gene Name:	NNMT nicotinamide N-methyltransferase [ Homo sapiens ]
Official Symbol:	NNMT
Synonyms:	NNMT; nicotinamide N-methyltransferase;
Gene ID:	4837
mRNA Refseq:	NM_006169
Protein Refseq:	NP_006160
MIM:	600008
UniProt ID:	P40261