"NNMT" Related Products

Expand
Expand

Recombinant Human NNMT Protein, GST-tagged

Cat.No.: NNMT-5956H
Product Overview: Human NNMT full-length ORF ( AAH00234, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
Description: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 54.78 kDa
AA Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: NNMT nicotinamide N-methyltransferase [ Homo sapiens ]
Official Symbol: NNMT
Synonyms: NNMT; nicotinamide N-methyltransferase;
Gene ID: 4837
mRNA Refseq: NM_006169
Protein Refseq: NP_006160
MIM: 600008
UniProt ID: P40261

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.