Recombinant Human NONO, His-tagged

Cat.No. : NONO-28748TH
Product Overview : Recombinant fragment, corresponding to amino acids 185-471 of Human nmt55 / p54nrb with N terminal His tag; MWt 36kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 185-471 a.a.
Description : This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Conjugation : HIS
Tissue specificity : Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.
Form : Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTV EPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGS FEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRK QLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGP ATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAF NRAAPGAEFAPNKRRRY
Sequence Similarities : Contains 2 RRM (RNA recognition motif) domains.
Gene Name NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
Official Symbol NONO
Synonyms NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD
Gene ID 4841
mRNA Refseq NM_001145408
Protein Refseq NP_001138880
MIM 300084
Uniprot ID Q15233
Chromosome Location Xq13.1
Pathway Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NONO Products

Required fields are marked with *

My Review for All NONO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon