Recombinant Human NONO Protein, His tagged, Avi-Biotinylated

Cat.No. : NONO-2497H
Product Overview : Avi-Biotinylated Recombinant Human NONO Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Molecular Mass : The protein has a calculated MW of 26 kDa.
AA Sequence : MHHHHHHGLNDIFEAQKIEWHEKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMD
Endotoxin : < 10 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.15 mg/mL
Storage Buffer : Sterile 50 mM Tris, pH7.5, 300 mM NaCl, 10% Glycerol
Gene Name NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
Official Symbol NONO
Synonyms NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein;
Gene ID 4841
mRNA Refseq NM_001145408
Protein Refseq NP_001138880
MIM 300084
UniProt ID Q15233

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NONO Products

Required fields are marked with *

My Review for All NONO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon