Recombinant Human ODC1 Protein, His-tagged
Cat.No. : | ODC1-323H |
Product Overview : | Recombinant Human ODC1 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 |
Molecular Mass : | 53.5kD |
AA Sequence : | MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGS |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | ODC1 ornithine decarboxylase 1 [ Homo sapiens ] |
Official Symbol | ODC1 |
Synonyms | ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC; |
Gene ID | 4953 |
mRNA Refseq | NM_002539 |
Protein Refseq | NP_002530 |
MIM | 165640 |
UniProt ID | P11926 |
◆ Recombinant Proteins | ||
ODC1-2974R | Recombinant Rhesus Macaque ODC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ODC1-3301H | Recombinant Human ODC1 protein, His-SUMO & Myc-tagged | +Inquiry |
ODC1-7018HF | Recombinant Full Length Human ODC1 Protein, GST-tagged | +Inquiry |
ODC1-351HF | Recombinant Full Length Human ODC1 Protein | +Inquiry |
ODC1-3617H | Recombinant Human ODC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ODC1 Products
Required fields are marked with *
My Review for All ODC1 Products
Required fields are marked with *
0
Inquiry Basket