Recombinant Human ODC1 Protein, His-tagged

Cat.No. : ODC1-323H
Product Overview : Recombinant Human ODC1 fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0
Molecular Mass : 53.5kD
AA Sequence : MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGS
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name ODC1 ornithine decarboxylase 1 [ Homo sapiens ]
Official Symbol ODC1
Synonyms ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC;
Gene ID 4953
mRNA Refseq NM_002539
Protein Refseq NP_002530
MIM 165640
UniProt ID P11926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ODC1 Products

Required fields are marked with *

My Review for All ODC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon