Recombinant Human PAH, GST-tagged
Cat.No. : | PAH-469H |
Product Overview : | Recombinant Human PAH (1 a.a. - 452 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria. |
Molecular Mass : | 78.2 kDa |
Sequence : | MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRL KKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDAD HPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYC GFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELL GHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEK PKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILAD SINSEIGILCSALQKIK |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | PAH |
Gene Name | PAH phenylalanine hydroxylase [ Homo sapiens ] |
Synonyms | PAH; PH; PKU1; PKU; phenylalanine hydroxylase; phenylalanine-4-hydroxylase; phe-4-monooxygenase; phenylalanine 4-monooxygenase; Phe-4-monooxygenase; EC 1.14.16 |
Gene ID | 5053 |
mRNA Refseq | NM_000277 |
Protein Refseq | NP_000268 |
MIM | 612349 |
UniProt ID | P00439 |
Chromosome Location | 12q22-q24.2 |
Pathway | Abnormal metabolism in phenylketonuria; Biogenic Amine Synthesis; Disease; Metabolism; Metabolism of amino acids and derivatives |
Function | amino acid binding cofactor binding; iron ion binding; phenylalanine 4-monooxygenase activity; protein homodimerization activity |
◆ Recombinant Proteins | ||
PAH-5510H | Recombinant Human PAH protein(2-452aa) | +Inquiry |
PAH-1318H | Recombinant Human PAH Protein, His-SUMO-tagged | +Inquiry |
Pah-5636M | Recombinant Mouse Pah protein, His-tagged | +Inquiry |
PAH-260H | Recombinant Human PAH Protein, His-tagged | +Inquiry |
PAH-12312M | Recombinant Mouse Pah Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAH-461HCL | Recombinant Human PAH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAH Products
Required fields are marked with *
My Review for All PAH Products
Required fields are marked with *
0
Inquiry Basket