Recombinant Human PAH, GST-tagged

Cat.No. : PAH-469H
Product Overview : Recombinant Human PAH (1 a.a. - 452 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.
Molecular Mass : 78.2 kDa
Sequence : MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRL KKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDAD HPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYC GFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELL GHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEK PKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILAD SINSEIGILCSALQKIK
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : PAH
Gene Name PAH phenylalanine hydroxylase [ Homo sapiens ]
Synonyms PAH; PH; PKU1; PKU; phenylalanine hydroxylase; phenylalanine-4-hydroxylase; phe-4-monooxygenase; phenylalanine 4-monooxygenase; Phe-4-monooxygenase; EC 1.14.16
Gene ID 5053
mRNA Refseq NM_000277
Protein Refseq NP_000268
MIM 612349
UniProt ID P00439
Chromosome Location 12q22-q24.2
Pathway Abnormal metabolism in phenylketonuria; Biogenic Amine Synthesis; Disease; Metabolism; Metabolism of amino acids and derivatives
Function amino acid binding cofactor binding; iron ion binding; phenylalanine 4-monooxygenase activity; protein homodimerization activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAH Products

Required fields are marked with *

My Review for All PAH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon