Recombinant Human PDGFB protein, His-tagged
Cat.No. : | PDGFB-3326H |
Product Overview : | Recombinant Human PDGFB protein(P01127)(82-190aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 82-190aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ] |
Official Symbol | PDGFB |
Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
Gene ID | 5155 |
mRNA Refseq | NM_002608 |
Protein Refseq | NP_002599 |
MIM | 190040 |
UniProt ID | P01127 |
◆ Recombinant Proteins | ||
PDGFB-3161H | Recombinant Human PDGFB Protein (Ser82-Thr190), His tagged | +Inquiry |
PDGFB-30560TH | Recombinant Human PDGFB | +Inquiry |
Pdgfb-639R | Recombinant Rat Pdgfb protein, His & GST-tagged | +Inquiry |
PDGFB-4403F | Recombinant Feline PDGFB Protein | +Inquiry |
PDGFB-095H | Active Recombinant Human PDGFB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *
0
Inquiry Basket