Recombinant Human PMP22 protein, His-tagged
Cat.No. : | PMP22-1811H |
Product Overview : | Recombinant Human PMP22 protein(31-133 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-133 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PMP22 peripheral myelin protein 22 [ Homo sapiens ] |
Official Symbol | PMP22 |
Synonyms | PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110; PMP-22; growth arrest-specific 3; growth arrest-specific protein 3; DSS; CMT1A; CMT1E; GAS-3; HMSNIA; MGC20769; |
Gene ID | 5376 |
mRNA Refseq | NM_000304 |
Protein Refseq | NP_000295 |
MIM | 601097 |
UniProt ID | Q01453 |
◆ Recombinant Proteins | ||
PMP22-30010TH | Recombinant Human PMP22 | +Inquiry |
RFL14546PF | Recombinant Full Length Pongo Abelii Peripheral Myelin Protein 22(Pmp22) Protein, His-Tagged | +Inquiry |
Pmp22-1955M | Recombinant Mouse Pmp22 Protein, His&GST-tagged | +Inquiry |
PMP22-6876M | Recombinant Mouse PMP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMP22-4473H | Recombinant Human PMP22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMP22 Products
Required fields are marked with *
My Review for All PMP22 Products
Required fields are marked with *