Recombinant Human POLK, His-tagged
Cat.No. : | POLK-838H |
Product Overview : | Recombinant Human POLK, fused with His tag C-Terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 to 560 |
Description : | External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass. |
Form : | Liquid |
Molecular Mass : | 64 kDa |
AA Sequence : | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADF PHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKT DKDKFVKPLE |
Purity : | >90% by SDS-PAGE. |
Applications : | ELISA; SDS-PAGE; Western blot; Functional Studies |
Storage : | Store at -20°C or -80°C. |
Concentration : | 3.2 mg/ml |
Gene Name | POLK?polymerase (DNA directed) kappa [?Homo sapiens?(human) ] |
Official Symbol | POLK |
Synonyms | POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; NP_057302.1; EC 2.7.7.7 |
Gene ID | 51426 |
mRNA Refseq | NM_016218 |
Protein Refseq | NP_057302 |
MIM | 605650 |
UniProt ID | Q9UBT6 |
Chromosome Location | 5q13 |
Pathway | Fanconi anemia pathway |
Function | DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding |
◆ Recombinant Proteins | ||
POLK-8768HFL | Recombinant Full Length Human POLK, Flag-tagged | +Inquiry |
POLK-1527H | Recombinant Human POLK protein | +Inquiry |
POLK-94H | Recombinant Human POLK Protein, His-tagged | +Inquiry |
POLK-137H | Recombinant Human DNA polymerase kappa | +Inquiry |
POLK-389HF | Recombinant Full Length Human POLK Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLK-3045HCL | Recombinant Human POLK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLK Products
Required fields are marked with *
My Review for All POLK Products
Required fields are marked with *