Recombinant Human PRL Protein

Cat.No. : PRL-065H
Product Overview : Recombinant human PRL protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 227
Description : This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
Form : lyophilized
Molecular Mass : 23.007 kDa
AA Sequence : MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Purity : > 95%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : -18°C
Concentration : 1 mg/mL
Storage Buffer : Sodium-phosphate (pH 8). Sterile-filtered colorless solution (reconst).
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name PRL prolactin [ Homo sapiens (human) ]
Official Symbol PRL
Synonyms PRL; prolactin; decidual prolactin;
Gene ID 5617
mRNA Refseq NM_000948
Protein Refseq NP_000939
MIM 176760
UniProt ID P01236

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL Products

Required fields are marked with *

My Review for All PRL Products

Required fields are marked with *

0
cart-icon