Recombinant Human PSAP protein, GST-tagged
Cat.No. : | PSAP-30115H |
Product Overview : | Recombinant Human PSAP (196-274 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp196-Val274 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PSAP prosaposin [ Homo sapiens ] |
Official Symbol | PSAP |
Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
Gene ID | 5660 |
mRNA Refseq | NM_001042465 |
Protein Refseq | NP_001035930 |
MIM | 176801 |
UniProt ID | P07602 |
◆ Recombinant Proteins | ||
Psap-1125R | Recombinant Rat Psap protein, His-tagged | +Inquiry |
PSAP-01H | Recombinant Human PSAP Protein, His-tagged | +Inquiry |
PSAP-18H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
PSAP-4756R | Recombinant Rat PSAP Protein | +Inquiry |
PSAP-13538M | Recombinant Mouse PSAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *