Recombinant Human RAC3
Cat.No. : | RAC3-31284TH |
Product Overview : | Recombinant full length Human RAC3 ; 189 amino acids, Predicted MWt 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 189 amino acids |
Description : | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. |
Molecular Weight : | 21.000kDa |
Tissue specificity : | Highest levels in brain, also detected in heart, placenta and pancreas. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 1mM EDTA, 0.1mM PMSF, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rho family. |
Gene Name | RAC3 ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [ Homo sapiens ] |
Official Symbol | RAC3 |
Synonyms | RAC3; ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); ras-related C3 botulinum toxin substrate 3; |
Gene ID | 5881 |
mRNA Refseq | NM_005052 |
Protein Refseq | NP_005043 |
MIM | 602050 |
Uniprot ID | P60763 |
Chromosome Location | 17q25.3 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RAC3-3936H | Recombinant Human RAC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAC3-1846H | Recombinant Human RAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAC3-6325H | Recombinant Human RAC3 protein, His-tagged | +Inquiry |
RAC3-18H | Active Recombinant Full Length Human Rac family small GTPase 3 Protein, His tagged | +Inquiry |
RAC3-6573C | Recombinant Chicken RAC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAC3 Products
Required fields are marked with *
My Review for All RAC3 Products
Required fields are marked with *