Recombinant Human RALB, His-tagged
Cat.No. : | RALB-28237TH |
Product Overview : | Recombinant full length Human RALB with an N terminal His tag; 227 amino acids with tag, Predicted MWt 25.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 203 amino acids |
Description : | This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. |
Conjugation : | HIS |
Molecular Weight : | 25.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC |
Gene Name | RALB v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) [ Homo sapiens ] |
Official Symbol | RALB |
Synonyms | RALB; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein); ras-related protein Ral-B; |
Gene ID | 5899 |
mRNA Refseq | NM_002881 |
Protein Refseq | NP_002872 |
MIM | 179551 |
Uniprot ID | P11234 |
Chromosome Location | 2q14.2 |
Pathway | CXCR4-mediated signaling events, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Pancreatic cancer, organism-specific biosystem; Pancreatic cancer, conserved biosystem; |
Function | GTP binding; GTP binding; GTPase activity; GTPase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
RALB-4916R | Recombinant Rat RALB Protein | +Inquiry |
Ralb-5358M | Recombinant Mouse Ralb Protein, Myc/DDK-tagged | +Inquiry |
RALB-117H | Recombinant Human RALB, GST-tagged | +Inquiry |
RALB-3778R | Recombinant Rhesus monkey RALB Protein, His-tagged | +Inquiry |
RALB-2166H | Recombinant Full Length Human RALB, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALB-2543HCL | Recombinant Human RALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RALB Products
Required fields are marked with *
My Review for All RALB Products
Required fields are marked with *