Recombinant Human RALB, His-tagged

Cat.No. : RALB-28237TH
Product Overview : Recombinant full length Human RALB with an N terminal His tag; 227 amino acids with tag, Predicted MWt 25.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203 amino acids
Description : This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.
Conjugation : HIS
Molecular Weight : 25.600kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC
Gene Name RALB v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) [ Homo sapiens ]
Official Symbol RALB
Synonyms RALB; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein); ras-related protein Ral-B;
Gene ID 5899
mRNA Refseq NM_002881
Protein Refseq NP_002872
MIM 179551
Uniprot ID P11234
Chromosome Location 2q14.2
Pathway CXCR4-mediated signaling events, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Pancreatic cancer, organism-specific biosystem; Pancreatic cancer, conserved biosystem;
Function GTP binding; GTP binding; GTPase activity; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RALB Products

Required fields are marked with *

My Review for All RALB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon