Recombinant Human RHOC, His-tagged

Cat.No. : RHOC-30285TH
Product Overview : Recombinant full length mature Human RHOC with N terminal His tag; 210 amino acids inclusive of tag, Predicted MWt 23.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 190 amino acids
Description : This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Conjugation : HIS
Molecular Weight : 23.800kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Sequence Similarities : Belongs to the small GTPase superfamily. Rho family.
Gene Name RHOC ras homolog gene family, member C [ Homo sapiens ]
Official Symbol RHOC
Synonyms RHOC; ras homolog gene family, member C; ARH9, ARHC; rho-related GTP-binding protein RhoC; RhoC;
Gene ID 389
mRNA Refseq NM_001042678
Protein Refseq NP_001036143
MIM 165380
Uniprot ID P08134
Chromosome Location 1p13.1
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem;
Function GTP binding; GTPase activity; nucleotide binding; protein domain specific binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOC Products

Required fields are marked with *

My Review for All RHOC Products

Required fields are marked with *

0
cart-icon