Recombinant Human RORB
Cat.No. : | RORB-30957TH |
Product Overview : | Recombinant full length Human ROR beta, isoform 1 (aa 1-459) with a N terminal proprietary tag: predicted molecular weight 76.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 459 amino acids |
Description : | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. |
Molecular Weight : | 76.560kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQN NASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAV KFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDS GQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNN GQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLF EGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNH LDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNT LFPPLYKELFNPDCATGCK |
Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR1 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
Gene Name | RORB RAR-related orphan receptor B [ Homo sapiens ] |
Official Symbol | RORB |
Synonyms | RORB; RAR-related orphan receptor B; nuclear receptor ROR-beta; NR1F2; ROR BETA; RZRB; |
Gene ID | 6096 |
mRNA Refseq | NM_006914 |
Protein Refseq | NP_008845 |
MIM | 601972 |
Uniprot ID | Q92753 |
Chromosome Location | 9q22 |
Pathway | Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; |
Function | ligand-dependent nuclear receptor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
RORB-3773R | Recombinant Rhesus Macaque RORB Protein, His (Fc)-Avi-tagged | +Inquiry |
RORB-6489H | Recombinant Human RORB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RORB-6650C | Recombinant Chicken RORB | +Inquiry |
RORB-3956R | Recombinant Rhesus monkey RORB Protein, His-tagged | +Inquiry |
RORB-5248Z | Recombinant Zebrafish RORB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RORB-2246HCL | Recombinant Human RORB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORB Products
Required fields are marked with *
My Review for All RORB Products
Required fields are marked with *