Recombinant Human SERPINE2, GST-tagged

Cat.No. : SERPINE2-2602H
Product Overview : Recombinant Human SERPINE2(1 a.a. - 398 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants.
Molecular Mass : 70.4 kDa
AA Sequence : MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKK QLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASAC DSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSV FRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIVDR PFLFFIRHNPTGAVLFMGQINKP
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SERPINE2 serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 [ Homo sapiens (human) ]
Official Symbol SERPINE2
Synonyms SERPINE2; GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2; glia-derived nexin; serpin E2; protease nexin I; peptidase inhibitor 7; glial-derived neurite promoting factor
Gene ID 5270
mRNA Refseq NM_006216
Protein Refseq NP_006207
MIM 177010
UniProt ID P07093
Chromosome Location 2q36.1
Pathway Dissolution of Fibrin Clot; Hemostasis
Function glycosaminoglycan binding; heparin binding; serine-type endopeptidase inhibitor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINE2 Products

Required fields are marked with *

My Review for All SERPINE2 Products

Required fields are marked with *

0
cart-icon