Recombinant Human SERPINE2, GST-tagged
Cat.No. : | SERPINE2-2602H |
Product Overview : | Recombinant Human SERPINE2(1 a.a. - 398 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 70.4 kDa |
AA Sequence : | MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKK QLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASAC DSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSV FRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIVDR PFLFFIRHNPTGAVLFMGQINKP |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SERPINE2 serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 [ Homo sapiens (human) ] |
Official Symbol | SERPINE2 |
Synonyms | SERPINE2; GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2; glia-derived nexin; serpin E2; protease nexin I; peptidase inhibitor 7; glial-derived neurite promoting factor |
Gene ID | 5270 |
mRNA Refseq | NM_006216 |
Protein Refseq | NP_006207 |
MIM | 177010 |
UniProt ID | P07093 |
Chromosome Location | 2q36.1 |
Pathway | Dissolution of Fibrin Clot; Hemostasis |
Function | glycosaminoglycan binding; heparin binding; serine-type endopeptidase inhibitor activity |
◆ Recombinant Proteins | ||
Serpine2-1308M | Recombinant Mouse Serine (or cysteine) Peptidase Inhibitor, Clade E, Member 2 | +Inquiry |
SERPINE2-3245H | Recombinant Human SERPINE2 protein, His-tagged | +Inquiry |
SERPINE2 -92R | Recombinant Rabbit PAI-1 biotin labeled latent fraction | +Inquiry |
SERPINE2-574H | Recombinant Full Length Human SERPINE2 Protein, His-tagged | +Inquiry |
SERPINE2-5643H | Recombinant Human SERPINE2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINE2-1937HCL | Recombinant Human SERPINE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINE2 Products
Required fields are marked with *
My Review for All SERPINE2 Products
Required fields are marked with *
0
Inquiry Basket