Recombinant Human SKP2
Cat.No. : | SKP2-31723TH |
Product Overview : | Recombinant full length Human SKP2 (amino acids 1-424) with N terminal proprietary tag; Predicted MWt 72.71 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 424 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. |
Molecular Weight : | 72.710kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSA LEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFV IVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGV IAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG ILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPT IGNKKNQEIWGIKCRLTLQKPSCL |
Sequence Similarities : | Contains 1 F-box domain.Contains 8 LRR (leucine-rich) repeats. |
Gene Name | SKP2 S-phase kinase-associated protein 2 (p45) [ Homo sapiens ] |
Official Symbol | SKP2 |
Synonyms | SKP2; S-phase kinase-associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1; |
Gene ID | 6502 |
mRNA Refseq | NM_001243120 |
Protein Refseq | NP_001230049 |
MIM | 601436 |
Uniprot ID | Q13309 |
Chromosome Location | 5p13 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; |
Function | protein binding; ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
SKP2-5233Z | Recombinant Zebrafish SKP2 | +Inquiry |
Skp2-5895M | Recombinant Mouse Skp2 Protein, Myc/DDK-tagged | +Inquiry |
SKP2-012H | Recombinant Human SKP2 Protein, His-tagged | +Inquiry |
SKP2-1465H | Recombinant Human S-Phase Kinase-Associated Protein 2 (p45), GST-tagged | +Inquiry |
SKP2-1819C | Recombinant Chicken SKP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKP2-1812HCL | Recombinant Human SKP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKP2 Products
Required fields are marked with *
My Review for All SKP2 Products
Required fields are marked with *
0
Inquiry Basket