Recombinant Human SULT1C2, His-tagged
Cat.No. : | SULT1C2-30914TH |
Product Overview : | Recombinant full length Human SULT1C2 (amino acids 1-296) with an N terminal His tag; 316aa, 37kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 296 amino acids |
Description : | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Conjugation : | HIS |
Molecular Weight : | 37.000kDa inclusive of tags |
Tissue specificity : | Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
Sequence Similarities : | Belongs to the sulfotransferase 1 family. |
Gene Name | SULT1C2 sulfotransferase family, cytosolic, 1C, member 2 [ Homo sapiens ] |
Official Symbol | SULT1C2 |
Synonyms | SULT1C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase family, cytosolic, 1C, member 1 , SULT1C1; sulfotransferase 1C2; ST1C1; |
Gene ID | 6819 |
mRNA Refseq | NM_001056 |
Protein Refseq | NP_001047 |
MIM | 602385 |
Uniprot ID | O00338 |
Chromosome Location | 2q12.3 |
Pathway | Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; |
Function | sulfotransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
SULT1C2-94H | Active Recombinant Human SULT1C2 Protein | +Inquiry |
SULT1C2-16221M | Recombinant Mouse SULT1C2 Protein | +Inquiry |
SULT1C2-947H | Recombinant Human SULT1C2, His-tagged | +Inquiry |
SULT1C2-892H | Active Recombinant Human SULT1C2 Protein, His-tagged | +Inquiry |
SULT1C2-8863M | Recombinant Mouse SULT1C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1C2-1351HCL | Recombinant Human SULT1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1C2 Products
Required fields are marked with *
My Review for All SULT1C2 Products
Required fields are marked with *
0
Inquiry Basket