| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
24-129 a.a. |
| Description : |
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. |
| Form : |
Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : |
13kD |
| AA Sequence : |
EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH |
| Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |