Recombinant Human TFF2 Protein, His-tagged
Cat.No. : | TFF2-588H |
Product Overview : | Recombinant Human TFF2 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-129 a.a. |
Description : | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 13kD |
AA Sequence : | EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TFF2 trefoil factor 2 [ Homo sapiens ] |
Official Symbol | TFF2 |
Synonyms | TFF2; trefoil factor 2; SML1, spasmolytic protein 1; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide; SP; SML1; |
Gene ID | 7032 |
mRNA Refseq | NM_005423 |
Protein Refseq | NP_005414 |
MIM | 182590 |
UniProt ID | Q03403 |
◆ Recombinant Proteins | ||
Tff2-01M | Recombinant Mouse Tff2 protein, His-tagged | +Inquiry |
TFF2-6029R | Recombinant Rat TFF2 Protein | +Inquiry |
TFF2-6420H | Recombinant Human TFF2 Protein (Ser27-His128), N-His tagged | +Inquiry |
Tff2-835R | Recombinant Rat Tff2 protein, His-tagged | +Inquiry |
Tff2-02M | Recombinant Mouse Tff2 Protein(Lys25~Cys127), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF2-1126HCL | Recombinant Human TFF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFF2 Products
Required fields are marked with *
My Review for All TFF2 Products
Required fields are marked with *
0
Inquiry Basket