Recombinant Human TPM3, His-tagged
Cat.No. : | TPM3-30392TH |
Product Overview : | Recombinant full length Human Tropomyosin 3 with N terminal His tag; 272 amino acids with tag, Predicted MWt 31.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 248 amino acids |
Description : | This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Mutations in this gene result in autosomal dominant nemaline myopathy, and oncogenes formed by chromosomal translocations involving this locus are associated with cancer. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 31.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAGITTIEAVKRKIQV LQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRI QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEN RALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVII EGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEE KYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKT IDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM |
Sequence Similarities : | Belongs to the tropomyosin family. |
Gene Name | TPM3 tropomyosin 3 [ Homo sapiens ] |
Official Symbol | TPM3 |
Synonyms | TPM3; tropomyosin 3; NEM1; tropomyosin alpha-3 chain; TRK; |
Gene ID | 7170 |
mRNA Refseq | NM_001043351 |
Protein Refseq | NP_001036816 |
MIM | 191030 |
Uniprot ID | P06753 |
Chromosome Location | 1q21.2 |
Pathway | Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; |
Function | actin binding; molecular_function; |
◆ Recombinant Proteins | ||
TPM3-93H | Active Recombinant Human TPM3+ALK co-expressed protein, GST-tagged | +Inquiry |
TPM3-30684TH | Recombinant Human TPM3 | +Inquiry |
Tpm3-8048M | Recombinant Mouse Tpm3 protein, His & T7-tagged | +Inquiry |
TPM3-11537Z | Recombinant Zebrafish TPM3 | +Inquiry |
TPM3-1380H | Recombinant Human TPM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPM3-842HCL | Recombinant Human TPM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPM3 Products
Required fields are marked with *
My Review for All TPM3 Products
Required fields are marked with *
0
Inquiry Basket