Recombinant Human WNT8A, StrepII-tagged
Cat.No. : | WNT8A-209H |
Product Overview : | Purified, full-length human recombinant WNT8A protein (amino acids 25-351, 327 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 36.3 kDa. (Accession NP_490645.1; UniProt Q9H1J5) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 25-351, 327 a.a. |
Description : | The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family, and may be implicated in development of early embryos as well as germ cell tumors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | VNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYI ITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRA TMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAEL IFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKC DQCRHVVSKYYCARSPGSAQSLGKGSA |
Endotoxin : | <0.1 eu per ug protein by lal method |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT8A wingless-type MMTV integration site family, member 8A [ Homo sapiens ] |
Official Symbol | WNT8A |
Synonyms | WNT8A; wingless-type MMTV integration site family, member 8A; protein Wnt-8a; WNT8D; WNT8d; protein Wnt-8d; |
Gene ID | 7478 |
mRNA Refseq | NM_058244 |
Protein Refseq | NP_490645 |
MIM | 606360 |
UniProt ID | Q9H1J5 |
Chromosome Location | 5q31 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem; |
Function | G-protein coupled receptor binding; frizzled binding; receptor agonist activity; |
◆ Recombinant Proteins | ||
WNT8A-1342HFL | Recombinant Full Length Human WNT8A Protein, C-Flag-tagged | +Inquiry |
WNT8A-2049HFL | Recombinant Full Length Human WNT8A protein, Flag-tagged | +Inquiry |
WNT8A-7079C | Recombinant Chicken WNT8A | +Inquiry |
WNT8A-209H | Recombinant Human WNT8A, StrepII-tagged | +Inquiry |
WNT8A-8586Z | Recombinant Zebrafish WNT8A | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT8A-287HCL | Recombinant Human WNT8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT8A Products
Required fields are marked with *
My Review for All WNT8A Products
Required fields are marked with *
0
Inquiry Basket