Active Recombinant Mouse Csf3 Protein

Cat.No. : Csf3-046M
Product Overview : Purified recombinant protein of Mouse colony stimulating factor 3 (granulocyte) (Csf3) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2 x 10^7 units/mg.
Molecular Mass : 19 kDa
AA Sequence : MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus (house mouse) ]
Official Symbol Csf3
Synonyms Csf3; colony stimulating factor 3 (granulocyte); Csfg; G-CSF; MGI-IG; granulocyte colony-stimulating factor
Gene ID 12985
mRNA Refseq NM_009971
Protein Refseq NP_034101
UniProt ID P09920

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon