Active Recombinant Mouse Csf3 Protein
Cat.No. : | Csf3-046M |
Product Overview : | Purified recombinant protein of Mouse colony stimulating factor 3 (granulocyte) (Csf3) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2 x 10^7 units/mg. |
Molecular Mass : | 19 kDa |
AA Sequence : | MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus (house mouse) ] |
Official Symbol | Csf3 |
Synonyms | Csf3; colony stimulating factor 3 (granulocyte); Csfg; G-CSF; MGI-IG; granulocyte colony-stimulating factor |
Gene ID | 12985 |
mRNA Refseq | NM_009971 |
Protein Refseq | NP_034101 |
UniProt ID | P09920 |
◆ Recombinant Proteins | ||
CSF3-1757H | Recombinant Human CSF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF3-178H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-481H | Recombinant Human CSF3, None tagged | +Inquiry |
Csf3-046M | Active Recombinant Mouse Csf3 Protein | +Inquiry |
Csf3-273M | Active Recombinant Mouse Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf3 Products
Required fields are marked with *
My Review for All Csf3 Products
Required fields are marked with *