Species : |
Mouse |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
272 |
Description : |
Predicted to enable co-receptor binding activity; low-density lipoprotein particle receptor binding activity; and receptor antagonist activity. Involved in several processes, including modulation of age-related behavioral decline; negative regulation of cellular component organization; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including Wnt signaling pathway involved in somitogenesis; embryonic morphogenesis; and negative regulation of signal transduction. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in extracellular space. Is expressed in several structures, including alimentary system; embryo mesenchyme; eye; genitourinary system; and nervous system. Human ortholog(s) of this gene implicated in anodontia. Orthologous to human DKK1 (dickkopf WNT signaling pathway inhibitor 1). |
Form : |
Lyophilized |
Molecular Mass : |
28 kDa |
AA Sequence : |
MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH |
Purity : |
> 98% |
Applications : |
WB; ELISA; FACS; FC |
Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : |
At -20 centigrade. |
Concentration : |
1 mg/mL |
Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |