Recombinant Mouse Lyve1 Protein, His-tagged

Cat.No. : Lyve1-7148M
Product Overview : Recombinant Mouse Lyve1 Protein (Met1-Gly228) fused to a C-terminal His tag (6×His) was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 1-228 a.a.
Description : Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
Predicted N Terminal : Ala24
Form : Lyophilized
Molecular Mass : 45 kDa
AA Sequence : ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
N-terminal Sequence Analysis : ADLVQDLS
Endotoxin : < 0.1 ng/μg of VEGF-C
Purity : > 95 % by SDS-PAGE and visualised by silver stain
Stability : Shelf life: one year from despatch.
Storage : Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
Avoid repeated freezing and thawing.
Storage Buffer : PBS
Reconstitution : Lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilised sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 μg/mL.
Gene Name Lyve1 lymphatic vessel endothelial hyaluronan receptor 1 [ Mus musculus (house mouse) ]
Official Symbol Lyve1
Synonyms Lyve1; lymphatic vessel endothelial hyaluronan receptor 1; Lyve; Xlkd; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik; lymphatic vessel endothelial hyaluronic acid receptor 1; cell surface retention sequence binding protein-1; extra cellular link domain-containing 1; extracellular link domain-containing protein 1; lymphatic vessel endothelial HA receptor-1; lymphatic vessel endothelial HA recptor-1
Gene ID 114332
mRNA Refseq NM_053247
Protein Refseq NP_444477
UniProt ID Q8BHC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lyve1 Products

Required fields are marked with *

My Review for All Lyve1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon