Recombinant Mouse Mif Protein (115 aa)

Cat.No. : Mif-331M
Product Overview : Recombinant mouse Macrophage Migration Inhibitory Factor (rmMIF) produced in E. coli is a single non-glycosylated polypeptide chain containing 115 amino acids. rmMIF has a molecular mass of 12.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 115
Description : Macrophage Migration Inhibitory Factor (MIF) is a pleiotropic cytokine, existing as a homotrimer in vivo. MIF was originally identified as a T cell derived factor responsible for the inhibition of macrophage migration. However, recently MIF has received much more attention because of its possible roles in angiogenesis and cancer development. MIF is over-expressed in various cancers, including pancreatic, breast, colon, brain, prostate, skin, and lung. The intratumoral expression MIF is strongly correlated with angiogenic growth factor expression, such as the expression of Interleukin 8 (IL-8) and Vascular Endothelial Growth Factor (VEGF), and with risk of recurrence after resection.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Bioassay data are not available.
Molecular Mass : 12.5 kDa, observed by reducing SDS-PAGE.
AA Sequence : MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant mouse Macrophage Migration Inhibitory Factor (rmMIF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmMIF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Mif macrophage migration inhibitory factor [ Mus musculus ]
Official Symbol Mif
Synonyms MIF; macrophage migration inhibitory factor; DER6; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; glycosylation-inhibiting factor; delayed early response protein 6; GIF; Glif; MGC107654;
Gene ID 17319
mRNA Refseq NM_010798
Protein Refseq NP_034928
UniProt ID P34884

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mif Products

Required fields are marked with *

My Review for All Mif Products

Required fields are marked with *

0
cart-icon