Recombinant Mouse PDCD1LG2 Protein, Fc-tagged
Cat.No. : | PDCD1LG2-719M |
Product Overview : | Recombinant Mouse PDCD1LG2 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 247 |
Description : | Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2). |
Form : | Lyophilized |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Pdcd1lg2 programmed cell death 1 ligand 2 [ Mus musculus (house mouse) ] |
Official Symbol | PDCD1LG2 |
Synonyms | PDCD1LG2; programmed cell death 1 ligand 2; PD-1 ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; butyrophilin-like protein; programmed death ligand 2; Btdc; B7-DC; PD-L2; F730015O22Rik; MGC124039; MGC124040; |
Gene ID | 58205 |
mRNA Refseq | NM_021396 |
Protein Refseq | NP_067371 |
UniProt ID | Q9WUL5 |
◆ Recombinant Proteins | ||
PDCD1LG2-132H | Recombinant Human PDCD1LG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdcd1lg2-542RAF488 | Recombinant Rat Pdcd1lg2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PDCD1LG2-827HAF488 | Recombinant Human PDCD1LG2 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PDCD1LG2-1282H | Active Recombinant Human PDCD1LG2 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
PDCD1LG2-129CAF647 | Recombinant Cynomolgus PDCD1LG2 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
PDCD1LG2-951CCL | Recombinant Cynomolgus PDCD1LG2 cell lysate | +Inquiry |
PDCD1LG2-2721HCL | Recombinant Human PDCD1LG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD1LG2 Products
Required fields are marked with *
My Review for All PDCD1LG2 Products
Required fields are marked with *
0
Inquiry Basket