Recombinant Rat CLEC12A Protein, His-tagged
Cat.No. : | CLEC12A-01M |
Product Overview : | Recombinant Rat CLEC12A Protein(NP_001128188.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH 7.4 |
Molecular Mass : | ~ 26.2 kDa, reducing condition. |
AA Sequence : | SGVFELKVLSFTSTSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAISEDWSQDVHLGRQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGC LHGTCNQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYKQKPTPVNSPALPAAHHHHHH |
Purity : | >90%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.417 mg/ml |
Gene Name | Clec12a C-type lectin domain family 12, member A [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CLEC12A |
Synonyms | CLEC12A |
Gene ID | 680338 |
mRNA Refseq | NM_001134716.1 |
Protein Refseq | NP_001128188.1 |
◆ Recombinant Proteins | ||
CLEC12A-213H | Active Recombinant Human CLEC12A Protein, hFc-tagged | +Inquiry |
CLEC12A-01M | Recombinant Rat CLEC12A Protein, His-tagged | +Inquiry |
CLEC12A-102R | Recombinant Rat CLEC12A Protein, His-tagged | +Inquiry |
CLEC12A-3547M | Recombinant Mouse CLEC12A Protein, His-tagged | +Inquiry |
CLEC12A-2641M | Recombinant Mouse CLEC12A Protein (65-267 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC12A-1920HCL | Recombinant Human CLEC12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC12A Products
Required fields are marked with *
My Review for All CLEC12A Products
Required fields are marked with *
0
Inquiry Basket